Us Wholesale Peptide CAS 86168 -78-7 Sermore. Lin Acetate with Best Price

China Us Wholesale Peptide CAS 86168-78-7 Sermore. Lin Acetate with Best Price, Find details about China Sermore. Lin Peptide Price, Sermore. Lin Peptide Vials from Us Wholesale Peptide CAS 86168-78-7 Sermore. Lin Acetate with Best Price

Model NO.
YH-Sermore. lin
CAS
62568-57-4
MOQ
1g
Sample
Free
Appearance
White Fine Powder
Test Method
HPLC, Hnmr, LC-Ms, UV, IR
Shelf Life
2 Years
Grade
Pharmaceutical Grade
Function
Anti-Depressant
Application
Capsules, Tablets, Pills
Storage
Keep It in Stored Desiccated Below -18° C
Delivery
7-10days by TNT, FedEx, EMS, DHL
Trademark
Yinherb
Transport Package
1g/Vial
Specification
99%
Origin
China
Model NO.
YH-Sermore. lin
CAS
62568-57-4
MOQ
1g
Sample
Free
Appearance
White Fine Powder
Test Method
HPLC, Hnmr, LC-Ms, UV, IR
Shelf Life
2 Years
Grade
Pharmaceutical Grade
Function
Anti-Depressant
Application
Capsules, Tablets, Pills
Storage
Keep It in Stored Desiccated Below -18° C
Delivery
7-10days by TNT, FedEx, EMS, DHL
Trademark
Yinherb
Transport Package
1g/Vial
Specification
99%
Origin
China
Us Wholesale Peptide CAS 86168-78-7 Sermore. Lin Acetate with Best Price
Yinherb Supply Sermore.lin Acetate Cas 86168-78-7(net), 114466-38-5(acetate) GHRH Sermore.lin
Name: Sermore.lin Acetate
Cas No: 86168-78-7(net),114466-38-5(acetate)
Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
Formula: C151H250N44O44S
Molecular:3417
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Geref, UNII-00IBG87IQW,AN-33322,GRF(1-29), GHRH(1-29), Serono Brand of Sermore.lin, Sermore.lina, Sermore.linum, Geref (TN), Sermore.line [French].
Appearance: White Lyophilized Powder
Minimum Order Quantity: 1 g
Brand Name: Yinherb
Test Method: HPLC
Storage: Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18° C. Upon reconstitution of the peptide it should be stored at 4° C between 2-21 days and for future use below-18° C. 
Us Wholesale Peptide CAS 86168-78-7 Sermore. Lin Acetate with Best PriceUs Wholesale Peptide CAS 86168-78-7 Sermore. Lin Acetate with Best Price


What is Sermore.lin Acetate?
Sermore.lin acetate (brand names Geref, Gerel), also known as GHRH (1-29), is a peptide analogue of growth- hormone-releasing hormone (GHRH) which is used as a diagnostic agent to assess secretion for the purpose of diagnosing growth -hormone deficiency. It is a 29-amino acid polypeptide representing the 1-29 fragment from endogenous human GHRH, thought to be the shortest fully functional fragment of GHRH.

Sermore.lin Acetate Benefits
1) Sermore.lin Strengthens the heart, Enhances the immune system
2) Sermore.lin Increases production
3) Sermore.lin Increases the development of lean body mass through the development of new muscle cells, Reduces body fat through lipolysis, Increases calcium retention, and strengthens and increases the mineralization of bone or bone density.
4) Sermore.lin Increases energy and vitality
5) Sermore.lin Increases strength and endurance
6) Sermore.lin Accelerates healing from wounds or surgery
7) Improves sleep quality

Sermore.lin Acetate Mode of Action
Sermore.lin / Sermore.lin acetate has a wide range of positive effects. Due to its nature as a GHRH, sermore.lin only increases the body's ability to produce more growth hor-mone, it is not an injection of growth hor-mone itself. In both a performance enhancing and general well-being sense, sermore.lin has a wide array of benefits that make it a powerful and valuable substance.

Sermore.lin Acetate Dosage
This depends on your body weight. All of the research carried out so far has used rodent studies, the rats and mice are usually injected with an effective dosage thought to be around 10 μg (mcg) per KG, in humans this is thought to be around the equivalent loading of 1.6 μg per KG in humans, so if you are: 
 
60 KG (132 lb.) then your ideal daily BPC-157 oral dose would be 96 μg (mcg)
70 KG (154 lb.) => 112 μg
80 KG (176 lb.) => 128 μg
90 KG (198 lb.) => 144 μg

Sermore.lin Acetate HPLC &NMR Test report by Yinherb 
Us Wholesale Peptide CAS 86168-78-7 Sermore. Lin Acetate with Best Price
Us Wholesale Peptide CAS 86168-78-7 Sermore. Lin Acetate with Best Price
Us Wholesale Peptide CAS 86168-78-7 Sermore. Lin Acetate with Best PriceUs Wholesale Peptide CAS 86168-78-7 Sermore. Lin Acetate with Best Price
Us Wholesale Peptide CAS 86168-78-7 Sermore. Lin Acetate with Best Price

Us Wholesale Peptide CAS 86168-78-7 Sermore. Lin Acetate with Best Price
Us Wholesale Peptide CAS 86168-78-7 Sermore. Lin Acetate with Best Price
Us Wholesale Peptide CAS 86168-78-7 Sermore. Lin Acetate with Best Price
Us Wholesale Peptide CAS 86168-78-7 Sermore. Lin Acetate with Best Price
Q1: Can i get some samples 
A: Yes, we can supply the free sample, but the shipping cost be paid by our customers.
 
Q2: How to start orders or make payments 

A: Proforma invoice will be sent first after confirmation of order, enclosed our bank information. Payment by T/T, Western Union or Paypal or Escrow(Alibaba).
 
Q3: How to confirm the Product Quality before placing orders 

A:You can get free samples for some products,you only need to pay the shipping cost or arrange a courier to us and take the samples. You can send us your product specifications and requests,we will manufacture the products according to your requests.
 
Q4:What's your MOQ 

A:Our MOQ is 1kg. But usually we accept less quantity such as 100g on the condition that sample charge is 100% paid.
 
Q5: How about delivery leadtime 

A:Delivery lead time: About 3-5 days after payment confirmed. (Chinese holiday not included)
 
Q6:Is there a discount 

A:Different quantity has different discount.
 
Q7: How do you treat quality complaint 

A:First of all, our quality control will reduce the quality problem to near zero. If there is a real quality problem caused by us, we will send you free goods for replacement or refund your loss.