anti aging FOXO4 D-Retro-Inverso peptide 95% FOXO4-DRI 98% Senolytics powder

EGF, FGF, KGF, SOD, FOXO4-dri and all cosmetic powder

Raw powder and freeze-dired fine powder are both available.




Physical Characters and specifications

Supply FOXO4-DRI raw powder and freeze powder in vials.

FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice

 

related products

No.	Product Name	CAS No.
Anti-wrinkle & Anti-aging Series
1	Acetyl Hexapeptide-8	616204-22-9
2	Acetyl Octapeptide-3/Snap-8	868844-74-0
3	Palmitoyl Tripeptide-5  /Collagen Peptide	623172-56-5
4	Palmitoyl Pentapeptide-4 /Matrixyl Acetate	214047-00-4
5	Pentapeptide-18 /Leuphasyl	64963-01-5
6	Hexapeptide-10/Serilesine	146439-94-3
7	Palmitoyl Hexapeptide / Lipopeptide Acetate	171263-26-6
8	Palmitoyl Tripeptide-1	147732-56-7
9	Pentapeptide-3/Vialox Peptide	135679-88-8
10	Acetyl Tetrapeptide-2	757942-88-4
11	Acetyl Tetrapeptide-9	928006-50-2
12	L-Carnosine	305-84-0
13	Decorinyl/Tripeptide-10 Citrulline	960531-53-7
14	Palmitoyl Tripeptide-38	1447824-23-8
15	Acetyl Decapeptide-3	935288-50-9
16	Hexapeptide-11	--------
Whitening & Freckle Removing Series
1	Nonapeptide-1/Melitane	158563-45-2
2	Tetrapeptide-30	---------
3	Decapeptide-12	---------
4	Hexapeptide-2	---------
5	Melanostatin DM	123689-72-5
6	Oligopeptide-68	1206525-47-4
Eye Care and Hair Growth Series
1	Acetyl Tetrapeptide-5/Eyeseryl	820959-17-9
2	Myristoyl Pentapeptide-17	959610-30-1
3	Myristoyl Tetrapeptide-12	959610-24-3
4	Acetyl Tetrapeptide-3/Capixyl	155149-79-4
5	Biotinoyl Tripeptide-1	299157-54-3
6	Melitane/Acetyl Hexapeptide-1	448944-47-6
7	Myristoyl Pentapeptide-4	---------
Anti-allergic & Skin Repair Series
1	Pal-Tetrapeptide-7 /Pal-Tetrapeptide-3	221227-05-0
2	Copper Peptide	49557-75-7
3	Hexapeptide-9	1228371-11-6
4	Palmitoyl Tripeptide-8	936544-53-5
5	Oligopeptide-10	---------
6	LZ1 Peptide	---------
Breast Series
1	Acetyl Hexapeptide-38	1400634-44-7
Weight Loss series
1	Acetyl Hexapeptide-39	---------