Products

China GMP Standard Manufacturer Supply 99% Medicine Peptide Exenatide Powder CAS: 141732 -76-5
China GMP Standard Manufacturer Supply 99% Medicine Peptide Exenatide Powder CAS: 141732 -76-5

China GMP Standard Manufacturer Supply 99% Medicine Peptide Exenatide Powder CAS: 141732 -76-5

China GMP Standard Manufacturer Supply 99% Medicine Peptide Exenatide Powder CAS: 141732-76-5, Find details about China 141732-76-5, Exenatide Powder from China GMP Standard Manufacturer Supply 99% Medicine Peptide Exenatide Powder CAS: 141732-76-5

Model NO.
141732-76-5
Trademark
Lx
Transport Package
Discreet Package
Specification
Customized
Origin
China
HS Code
3824999999
Model NO.
141732-76-5
Trademark
Lx
Transport Package
Discreet Package
Specification
Customized
Origin
China
HS Code
3824999999

China GMP Standard Manufacturer Supply 99% Medicine Peptide Exenatide Powder CAS: 141732-76-5

Name:Exenatide Acetate, Exenatida  
Cas No:141732-76-5
Formula: C186H286N50O62S
Molecular:4246.62
Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Purity:98%
Appearance: white powder
Source: synthetic
Also know as AC 2993, Bydureon, Byetta, Exenatide synthetic, Synthetic exendin-4
 
China GMP Standard Manufacturer Supply 99% Medicine Peptide Exenatide Powder CAS: 141732-76-5
China GMP Standard Manufacturer Supply 99% Medicine Peptide Exenatide Powder CAS: 141732-76-5

 

The amino acid sequence of Exenatide Acetate partially overlaps with human GLP-1. Exenatide acetate has been shown to bind to and activate the known human GLP-1 receptor in vitro. This means that by including cAMP (cyclic adenosine monophosphate) or other intracellular signaling mechanisms, glucose-dependent insuli synthesis and insuli secretion by pancreatic β cells in the body are increased.

Application

Application of exenatide acetate causes an increase in acinar cAMP without stimulating amylase release. As an incretin mimetic, exenatide acetate acts as agonist of the glucagon-like peptide-1 (GLP-1) receptor. As GLP-1, though with prolonged activity, exenatide acetate augments the postprandial production of insuli and suppresses secretion of glucagon. For this reason, exenatide acetate has found use as a medication of diabetes II.


Package:100g,1kg,25kg 

 
China GMP Standard Manufacturer Supply 99% Medicine Peptide Exenatide Powder CAS: 141732-76-5
China GMP Standard Manufacturer Supply 99% Medicine Peptide Exenatide Powder CAS: 141732-76-5

 

 
By ExpressBy Air By Sea 
Suitable for under 50kgSuitable for more than 50kgSuitable for more than 500kg
Fast: 3-7 daysFast: 3-7 daysslow: About 7-20 days 
Door to door servicePort to port servicePort to port service



China GMP Standard Manufacturer Supply 99% Medicine Peptide Exenatide Powder CAS: 141732-76-5



About us 

China GMP Standard Manufacturer Supply 99% Medicine Peptide Exenatide Powder CAS: 141732-76-5

Our Advantages:     
The 7 reasons are as below:
1Rich experienceOur company is a professional leading supplier in pharmaceutical and chemical area for many years.
2Suitable packagingsThe packing suits you best would be choosen to cross customs safely. Or if you have your own ideal way, it could be also taken in consideration.
3High qualityHigh quality guaranteed, product is tested before shipment.
4Secure shippingShipping by professional forwarder Security EMS/DHL/TNT/FedEx/UPS,AusPost,Royal Mail express,etc.Door to door service.
5Fast deliveryWe have stock, so we can deliver quickly once payment isreceived.
6Quality serviceWarm aftersale service is supplied,if any question we will reply you within 8 hours.
7Competitive pricesA discount would be given when you make a large order. VIP price for next orders.

China GMP Standard Manufacturer Supply 99% Medicine Peptide Exenatide Powder CAS: 141732-76-5
About product:
-Health products raw materials
-Nutritional supplements
-Cosmetic raw materials
-Various types of raw materials

About price:
Due to environmental issues and factory shutdown issues, the prices of certain raw materials may be unstable.Therefore, we need to update prices in real time. Please ask us in advance!



China GMP Standard Manufacturer Supply 99% Medicine Peptide Exenatide Powder CAS: 141732-76-5
China GMP Standard Manufacturer Supply 99% Medicine Peptide Exenatide Powder CAS: 141732-76-5



FAQ

Q1:Can I get some raw steroids samples?
A:Sure,we can supply the free powder sample,just pay shipping cost.
 
Q2:How to make orders?
A:Please send inquiry to us,after we come to an agreement,send payment via Paypal, Bitcoin,Western Union,Moneygram or Bank account,then we ship products out and give tracking number to you.
 
Q3:How to delivery?
A:Pack shipped in 2 days(Chinese holiday not included) after payment,usually ship via Fedex,EMS,HKEMS,DHL,TNT,UPS,NL Post,USPS  Domestic fast shipping,signature not requested.

Q4:Is there any discount?
A:Yes.The price is negotiable,If you order large quantity or some products together,you will get discount and enjoy free shipping.
 
Q5:What is the Minimum order quantity?
A:The Min. order quantity according to your request,10g,50g all is OK.
The price is negotiable,it according to the order quantity,the larger the order is,the better the price is.

You Might Also Like