China 99% Purity High Quality Cosmetic Peptides Foxo4-Dri for Treatment of Rejuvenation by Therapeutic Elimination of Senescent Cells, Find details about China Foxo4-Dri, Peptide Foxo4-Dri from 99% Purity High Quality Cosmetic Peptides Foxo4-Dri for Treatment of Rejuvenation by Therapeutic Elimination of Senescent Cells
Name | FOXO4 DRI |
CAS | N/A |
Grade Standard | Injection grade |
COA | Pls contact with Senwayer freely |
MOQ | 10mg |
Appearance | White powder |
Purity, % (by RP-HPLC) | 99% |
Product Description
FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.
Function & Application
FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice
Hot Sale Products
• Q1: Can I get some samples?
A: Yes, we can supply the free sample, but the shipping cost be paid by customers.
• Q2: How to start orders or make payments?
A : PI will be sent first after confirmation of order,enclosed our bank information.Payment by T/T, Western Union LC,Alibaba trade assurance ,Moneygram or Paypal.
• Q3: What's your MOQ?
A : Our MOQ is 1kg. But usually we accept less quantity such as 100g on the condition that
sample charge is 100% paid.
• Q4: How about delivery leadtime?
A : Delivery lead time: About 3-5 days after payment confirmed.(Chinese holiday not included)
• Q5: Is there a discount?
A : Different quantity has different discount.
• Q6: How to contact us ?
A : You can chat with us by Trademanager,MSN&Skype Online. You can choose your interested products and send inquiry to us. You can dial our telephone directly, you will get our reply. Send Email to us.
• Q7: How to confirm the Product Quality before placing orders?
A : You can get free samples for some products,you only need to pay the shipping cost or
arrange a courier to us and take the samples. You can send us your product specifications
and requests,we will manufacture the products according to your requests.