Anti aging Senolytics Foxo4 D-Retro-Inverso Peptide powder 95% FOXO4-DRI peptide
FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.
FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice
Product Name | FOXO4-DRI peptide |
CAS | NA |
Appearance | White powder |
MOQ | 10mg |
Purity | 95% |
Shelf Life | 24 Months |
Function
Within a certain concentration range, FOXO4-DRI can effectively kill senescent cells without affecting non-senescent cells and reverse senescence
Xi'an Wucine Bio Industries Inc is a national key high-tech enterprise,which mainly specializes
in the R&D,operation and production of pharmaceuticals,and intermediates.Our company is
situated in E&T development zone,xi'an city shaanxi,it is easy of access.Our company has
independent R&D center,raw material synthesis workshop,has advanced quality instruments
and equipmentm,several product patents there are 15 experts in our research team.We insist
in innovation and produce high quality products.
1. Are you a manufacturer or trade company?
We are a professional manufacturer.
2.What's your payment terms?
Standard terms: T/T in advance and Western Union.
Also L/C at sight is acceptable for large amount.
3.What's your shipping time?
We have a large stock, which means we can deliver the goods to you immediately.
4.How do you ensure the quality of your products?
Strict QC with 6 steps testing from raw material purchase to finished product.
5.How do you ship the order normally?
For large qty order,ship the goods by sea.
For small qty order, by air or express. We supply optional express for you, including DHL,FEDEX,UPS,TXT,EMS,and so on.
6.What's your loading port?
Usually Shanghai, Qingdao, Tianjin, Guangzhou