Name:GLP-1(7-36), IRP peptide
Cas No: 119637-73-9, 107444-51-9
Formula: C149H226N40O45
Molecular: 3297
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Glp-1a, Glp-I (7-36)amide, Glp-1 (7-36)amide, Glp-I (7-36)NH2, Glucagon-like peptide I (7-36)amide,
1. Professionalism of production: With more than 20 years of experience in peptide production, to ensure the stability and reliability of each batch of peptide quality.
2. Professionalism of product efficacy: We are familiar with more than 300 kinds of cosmetic peptides that are now available worldwide, thorough research.
3.Professionalism of service:customer satisfaction is our greatest work.
4. Reliability: We always believe that only good reputation and product quality can make a good company.
5. Flexibility:We offer a variety of peptides, liquid, freeze-dried powder etc.
6. Variety of products: We offer more than 200 peptides, including Dipeptide, Tripeptide, Tetrapeptide, Pentapeptide, Hexapeptide, Heptapeptide,Octapeptide,Nonapeptide,Decapeptide,Copper peptide, Oligopeptide and so on.
Q1: Can I get some samples?
A: Yes, we can supply the free sample in some peptide, but the shipping cost is paid by your side.
Q2: How do I make an order?
A: Simply click our Head Portraits on the right of the website page.Then,you can talk with us.We will contact you and be happy to
assist you with your order.
Q3: How to start orders or make payments?
A: Proforma invoice will be sent first after confirmation of order, enclosed our bank information.We accept T/T (Telegraphic
Transfer),Western Union or Paypal or Escrow(Alibaba).
Q4: How about delivery leadtime?
A:Delivery lead time: About 3-5 days after payment confirmed. (Chinese holiday not included)
Q5:Is there a discount?
A:Different quantity has different discount.
Q6: How do you treat quality complaint?
A:First of all, our quality control will reduce the quality problem to near zero. If there is a real quality problem caused by us,
we will send you free goods for replacement or refund your loss.